PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010531036.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family ZF-HD
Protein Properties Length: 318aa    MW: 36162.3 Da    PI: 9.9305
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010531036.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer97.41.1e-30108164259
     ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                     +kvrY+eC++NhAa+ Ggh+vDGCgEfmp+ ge  t+++l+CaA +CHR+FHRrev+ 
  XP_010531036.1 108 QKVRYRECQRNHAANSGGHVVDGCGEFMPA-GEGDTPESLRCAASDCHRSFHRREVDG 164
                     789**************************9.77789*******************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-22109172IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.5E-27110162IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.8E-27111162IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.413112161IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466893.94E-15245308IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.2E-26247310IPR009057Homeodomain-like
TIGRFAMsTIGR015658.0E-27252308IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MEMGEKEREM EMPSSFRYYT SSTDHHGRRK KQATDHQTLY HHHHRPPPPP PIHHGVSERS  60
KPTSRDSDPN LNSDSEPEPV SATPVSPLPR SHARPSPPSH LHHHLRQQKV RYRECQRNHA  120
ANSGGHVVDG CGEFMPAGEG DTPESLRCAA SDCHRSFHRR EVDGELTLNL NTFGHYNVVA  180
ATGKVSSQRN QVFPPPRKPP PPPLLLHHHA SPIMMSFGGG GGGGPAESST EDLNKFHQSL  240
SANGIDQLQQ PRKRFRTKFN QEQKEKMQEF ADKIGWRITK QDDEELQRFC SQINVRRQVF  300
KVWMHNNNKQ AAARKKQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A4e-202533071872ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010531036.10.0PREDICTED: zinc-finger homeodomain protein 6-like
RefseqXP_010531037.10.0PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotQ9ZPW71e-93ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A078JR936e-98A0A078JR93_BRANA; BnaCnng66730D protein
STRINGscaffold_304185.17e-92(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-81homeobox protein 24